SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y69A2AR.26 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y69A2AR.26
Domain Number 1 Region: 124-318
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-35
Family Nuclear receptor ligand-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 18-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-26
Family Nuclear receptor 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y69A2AR.26   Gene: WBGene00022097   Transcript: Y69A2AR.26
Sequence length 323
Comment pep:known chromosome:WBcel235:IV:2578932:2581583:-1 gene:WBGene00022097 transcript:Y69A2AR.26 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLGSTTSSSTPSSQTSELCAVCGGKASSSRYGALSCIGCLVFFRRMTCGEKKWYCLRN
RNCEINIATRNTCRACRLQKCLNVGMNPNAIQRRDEIGPRKPKVSKHRLTCAQNFSFSGE
TQNNFSQKQYNAATSSECAMCLHIGFQNALEWANQLESFSMLSHVDKQNILSEYGIAFTL
IDQGYKTARDADEQCWLLQNGSVLHCEQLFNSSDADLVNQLIANISQPLKRLELDEYECG
LLKSLLLLSSSFPGEVQLNSQQSRAKCLTEMLQHRNDPERFGEIILLIGSIRSSVKLFYN
QTKRSDLFNVLNFSYFVRNNMAC
Download sequence
Identical sequences Y69A2AR.26 NP_500225.3.50509 Y69A2AR.26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]