SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y70C5C.6a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y70C5C.6a
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-21
Family Nuclear receptor 0.0018
Further Details:      
 
Domain Number 2 Region: 116-331
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000000112
Family Nuclear receptor ligand-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: Y70C5C.6a   Gene: WBGene00003702   Transcript: Y70C5C.6a
Sequence length 342
Comment pep:known chromosome:WBcel235:V:16722061:16723844:-1 gene:WBGene00003702 transcript:Y70C5C.6a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKICGSSESEPHFGGTSCRACAAFFRRFYHSKKLGLKCTCKTRQSNAHPCRSCRIRKCY
EAGMTPEKIQLTRDKHLNRTIKLEGPCSSLDTPITSRQTPNLYCVLSNWHELKMTREEMN
SGSLNNCNIFELTSFVLRDLELTWRMVSKAFPTVEVLEDRDRQALLRNFVPKLWQIEPIL
EYRECAEKFDNLEEEDYENLLVGFYGGTFPEGKEMSKSEIVSNFRPYWDYYYTKMILPIS
SMGLEELEYMAIVWLAFFDNGYSNISDNCLEMCRDIQKVILKELRNYQIDRNFHENRFFV
ALEALQIIERGEKKFMEEMLVCEMNHIRIHDDFRKIIREPKL
Download sequence
Identical sequences O62496
NP_001024286.1.50509 Y70C5C.6a Y70C5C.6a Y70C5C.6a 6239.Y70C5C.6a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]