SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y70C5C.6b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y70C5C.6b
Domain Number 1 Region: 82-297
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000000858
Family Nuclear receptor ligand-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y70C5C.6b   Gene: WBGene00003702   Transcript: Y70C5C.6b
Sequence length 308
Comment pep:known chromosome:WBcel235:V:16722061:16723844:-1 gene:WBGene00003702 transcript:Y70C5C.6b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLRCIFPQILSLEKARLKMIRKCYEAGMTPEKIQLTRDKHLNRTIKLEGPCSSLDTPI
TSRQTPNLYCVLSNWHELKMTREEMNSGSLNNCNIFELTSFVLRDLELTWRMVSKAFPTV
EVLEDRDRQALLRNFVPKLWQIEPILEYRECAEKFDNLEEEDYENLLVGFYGGTFPEGKE
MSKSEIVSNFRPYWDYYYTKMILPISSMGLEELEYMAIVWLAFFDNGYSNISDNCLEMCR
DIQKVILKELRNYQIDRNFHENRFFVALEALQIIERGEKKFMEEMLVCEMNHIRIHDDFR
KIIREPKL
Download sequence
Identical sequences Y70C5C.6b Y70C5C.6b NP_001024287.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]