SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y71F9AM.4a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Y71F9AM.4a
Domain Number - Region: 47-110
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: Y71F9AM.4a   Gene: WBGene00022121   Transcript: Y71F9AM.4a
Sequence length 794
Comment pep:known chromosome:WBcel235:I:2931461:2947152:1 gene:WBGene00022121 transcript:Y71F9AM.4a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIDHMRTVELLAAKAATWGLPEAVEDAESDTEEDVVGLISGALKDIKKREKDLAELQFP
PEITAIRSNMKRFRDLQKQIDNSKATMNELREAYESVSSRTCSLHDACDRALAEQTSLST
GSQLIKTNLYYFKQADAIMKKLSVAKLMVTGHSFAAILVSIDECLTYLRAHPEYKESEAY
ISKFEQCLSRAMTWVRVAVLADLEACFNAVKDRQAQLELDYEKIGRAGQEEDTFALLYGV
FASKAAVVKASINVVEQRFSAVPEFEEMLAECQYAYFAKRNLLLGPILESTLANLSGTHD
DSTCRLTRDACTFMLRTCDDEYRLYRQFFVTRHTEERKLSTDGRISPAMSTITSVFTSAQ
SPQQVHPFETFSEQMCRTLYDMLRPRIVHNPHLETLAELCTMIKIEMIENRCSLQMVASI
LGDDASNDQNVSGLNPRAGFVSVMSELVGDIAERIVYRAGMYAQNDIAAYRPAAGDIAYP
QMLQMIRKIENEQKEQQEKEPEEGSAPATAIDQHCLWYPTVRRTVMCLSKIFPCLDIGVF
HSLARDMLFSCIDSLETASKAIMESPAPAKGWSKKLDAHLFVVKHLLILREQTAPYRQNV
LSFRSDSLNTKDFSIDFSKFTNVLFDSKSKWFELSTDNALLELITTVPIEMREQEGDSRR
VLDQQLRASTFRLAHEASLLMIRDLADWIEIAEDERMKEGFQLSGHPKLAAGVLKDVSAV
AYRNVGTKFTEIRAAYTLYIGVPETEEILLSPVRKRVIDIFTRVISFASKTYDAESLAIA
GLPNVQQLILLLNK
Download sequence
Identical sequences Q6AW08
Y71F9AM.4a.1 6239.Y71F9AM.4a Y71F9AM.4a NP_001021806.1.50509 Y71F9AM.4a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]