SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y94H6A.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y94H6A.1
Domain Number 1 Region: 232-465
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.34e-27
Family Nuclear receptor ligand-binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 67-148
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-20
Family Nuclear receptor 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: Y94H6A.1   Gene: WBGene00022374   Transcript: Y94H6A.1
Sequence length 498
Comment pep:known chromosome:WBcel235:IV:2743007:2747476:1 gene:WBGene00022374 transcript:Y94H6A.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTNMLLHADHHFYSSSQFASYYQYSQSSQFFEQMLRESSEIRAPSSGESRIPVVGRLKM
PPPPPKLKHCEVCGNAGATSHYGGTVCGGCKIFFSRTVQSRKGFVCERGGQCPMNAGKRA
KCRACRFQLCLKARMSPEEVGRLRDMRMGDYLPIVKKEGCVVGYFDESSQPSTSIEDCTS
QVHSFIDTFKYKEDEMSVVNIFVNLERSCENNAALCYRDDFPKTFNASIDLQSAMEFPLP
ICERIPMDFLRKLFLRDPKENFKLFWCRSVLHFLQWCSAIEDLNYFSRQERTMLIAENFV
SIGCLINFYGFLKIQREEFENCPEDGQIPAPCSAEWFQELSGLSFEAQTAVHRAISEIME
PMDSLDVSIEELVLMKFIMMFSEPSTQTSGDIYRIRSYRLKYCELLQKYIKTQIPDPERR
IARIGELLKIVEAVKTTSQYFDKWMTMFFASNTCQMNDVLVYDFHVRMWSDVIPTSTSSS
SSSIFATSSTLQKIKKEY
Download sequence
Identical sequences Q9N2W3
NP_500250.2.50509 Y94H6A.1 Y94H6A.J Y94H6A.1 6239.Y94H6A.1 Y94H6A.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]