SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZC410.1e from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZC410.1e
Domain Number 1 Region: 10-273
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.24e-39
Family Nuclear receptor ligand-binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ZC410.1e   Gene: WBGene00003610   Transcript: ZC410.1e
Sequence length 277
Comment pep:known chromosome:WBcel235:IV:9071974:9073607:1 gene:WBGene00003610 transcript:ZC410.1e gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYSIENNSILQYYHSMETGLCSKRRIMYTNTGMDFILDTHANLQCPFTVNDLRPHDYRN
FRGMLRHDFVMLFDYATRFPEFNSFTSHEKNMFYRQIVAVDFILSSAYYTAKLGQAHRQM
VLTNGEYLNMDPLPMSGNEIDARRYFDCDEDFSKYRALMPMHIAIWEESIVPFSKLNVTF
EEFCLLKALTVWQATYFKLTENGREKCRRQRNIIIGFLSKMCHSPGGGGEHRVGELLMSM
NYLRESAQKLTTSYVMLTVFNVLNCDSMLHEMLNFQY
Download sequence
Identical sequences H9G2T0
NP_001255360.1.50509 ZC410.1e

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]