SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK1037.13 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1037.13
Domain Number 1 Region: 41-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-23
Family Nuclear receptor 0.0012
Further Details:      
 
Domain Number 2 Region: 113-129,165-278
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.27e-16
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ZK1037.13   Gene: WBGene00045515   Transcript: ZK1037.13
Sequence length 291
Comment pep:known chromosome:WBcel235:V:15318961:15320553:1 gene:WBGene00045515 transcript:ZK1037.13 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASWVISLTQGTSMYKNQKHLCVIPLVFPQMSNSETTSDCCSVCGGAPNGGHRYGPMAC
LSCITFFRRAISSGNVGDCKKQSACEINHESKNSCRSCRLQKCLNVGMNPKAIQHRDPIG
QRSPPKDDSDSQKSDLQFLLDLQKKQRIRNQKYGIQLKNDRSVKKQYRPANADDIRLTMS
LGFQNAISWANPFEAFKNLTDSEKAAVMSEFGVAFVLIEQAFKSAKEADEGVWLLQNNTF
LGLKEGESVQAKINSEFVKTLLKTLCEPIRTLQLDKFDVFPKQRETRKCRT
Download sequence
Identical sequences A7LPI6
NP_001123077.1.50509 ZK1037.13 ZK1037.13 ZK1037.13 6239.ZK1037.13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]