SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK381.3.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK381.3.2
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000272
Family Nuclear receptor ligand-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ZK381.3.2   Gene: WBGene00022726   Transcript: ZK381.3.2
Sequence length 115
Comment pep:known chromosome:WBcel235:IV:6971916:6972527:-1 gene:WBGene00022726 transcript:ZK381.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILLQYVEFSNLWVDGLWAEIQLEQWNKISNTSESISFGADNIHFSTFISNFRSSVGEP
MAHLKLDMVEYAALKALCFWKLGYVDFGVTLKIVAQEHYLLVSTALTDYHLAEKG
Download sequence
Identical sequences Q9GYF7
ZK381.3 ZK381.3 6239.ZK381.3.1 ZK381.3.1 NP_501076.2.50509 ZK381.3.1 ZK381.3.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]