SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK455.6 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK455.6
Domain Number 1 Region: 143-387
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.33e-30
Family Nuclear receptor ligand-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 13-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.66e-28
Family Nuclear receptor 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ZK455.6   Gene: WBGene00013976   Transcript: ZK455.6
Sequence length 413
Comment pep:known chromosome:WBcel235:X:11318278:11321076:1 gene:WBGene00013976 transcript:ZK455.6 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKVMNDPEDLGNCKICLQRADGIHFAVSSCRACAAFFRRTVILKLNYTCKEKGNCTVEK
SLRNLCRSCRYTRCINEGMKIELVQLQRDSIGRKKSGASISIDPLFTPNVASSLSAIFKN
EKEDVLSTSCTILSQMTSGYAMFLNIRRSTNTLVQSSVITPTFKMPKIELHASRFDSAKQ
VCKAEAHLVTDIVNSYFSPFNSLKFEDKVALFKNFFCYFSHTDRAYQSFKQFESDNLNDK
ILMPDGGFIKRTELGRFYENAEGVHTSAEDAAKIFQPALNYILDVIVDYMRRIHIIETEY
LALLGFCLWDDAVPGLSKEAKSLAVQTQSKLLAELQNFYSSQNKDAVEITQRVGVLLLLV
PKLTKCVIMLRENSVLAELFNYYEADVCCKNFKEDASVDLDCTSQCIVHTKND
Download sequence
Identical sequences G5ED47
NP_509893.3.50509 ZK455.6 ZK455.6 ZK455.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]