SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0513.2b.2 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0513.2b.2
Domain Number - Region: 68-174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: B0513.2b.2   Gene: B0513.2   Transcript: B0513.2b.2
Sequence length 210
Comment pep:known chromosome:WBcel215:IV:13882761:13884049:1 gene:B0513.2 transcript:B0513.2b.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEDTLLRKLVADGEGVGDDRKVQQIATFFRESRKEDAKTSVPEAVKVTKALEFLELSML
KQKRISHMNKIHATECDQFAEEIDQSIEEMYKKMEVAKNELADAKIVKRNRQEYRKLVNV
LEEVPSRAETTRKLGEVKDDLERQHERQKVLEAKLMDRRNHLQAFMIILSNFQRFCAEDD
DDDAEVMSNPGEDDDAASVTEKQQEDDVRK
Download sequence
Identical sequences Q9U3S3
B0513.2a.1 B0513.2a.2 6239.B0513.2.1 B0513.2a NP_001255765.1.50509 B0513.2b.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]