SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F57A10.2 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F57A10.2
Domain Number 1 Region: 24-154
Classification Level Classification E-value
Superfamily PapD-like 6.11e-27
Family MSP-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F57A10.2   Gene: F57A10.2   Transcript: F57A10.2
Sequence length 155
Comment pep:known chromosome:WBcel215:V:15766556:15767255:1 gene:F57A10.2 transcript:F57A10.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAAKTFTPSTADLPFTDAGASEDSGMANKPGEPAFQLWLDVKKVVFPTTSEPSYVNLR
LHNPTDKRITFKVRCTSAELFRVQPPIAFINAGATVNLVMWSANTHLQPEKKHYFAFYHK
NASPSARQSPPLWKDGLKDAEGVRRIPVVFLPPSS
Download sequence
Identical sequences O45592
F57A10.2 F57A10.2 F57A10.2 NP_506928.1.50509 6239.F57A10.2 F57A10.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]