SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F58F9.6 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F58F9.6
Domain Number - Region: 26-82
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: F58F9.6   Gene: F58F9.6   Transcript: F58F9.6
Sequence length 291
Comment pep:known chromosome:WBcel215:IV:6235966:6237532:-1 gene:F58F9.6 transcript:F58F9.6 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLLCVVFICISVSVALPECSNRICENGGLWSEWTTTEACPTECGSCSKILYTRKCLSS
SLADCDCKGESSSLKLCNTQTCLPASARRPCCKPYTPLKIKKTMQCGPLPEEDTDTSKPC
CPKGGLWSSWSGYIRNYASNGWERTRSCLSGTAGCQCTGSTVETSNKCPCRAMIDVSDKV
KRNLKTFPLSVDYDGNSCTARQNLEYFNNVPTQIVPCNAWKNYLYTAAIRYVTPNDKIVE
QRVANCLALGQKQVSLFCDLNSGYWRLVSNNDEVVGFNLINLILSWGSYVL
Download sequence
Identical sequences Q20991
F58F9.6 NP_500942.1.50509 F58F9.6 F58F9.6 6239.F58F9.6 F58F9.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]