SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T13F2.10 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T13F2.10
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily PapD-like 3.4e-36
Family MSP-like 0.000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: T13F2.10   Gene: T13F2.10   Transcript: T13F2.10
Sequence length 127
Comment pep:known chromosome:WBcel215:IV:9766725:9767167:-1 gene:T13F2.10 transcript:T13F2.10 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC
GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMARRKN
LPIEYNP
Download sequence
Identical sequences Q9TVW5
F32B6.6 T13F2.10 6239.F32B6.6 6239.T13F2.10 NP_501740.1.50509 NP_501781.1.50509 F32B6.6 T13F2.10 F32B6.6 T13F2.10 F32B6.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]