SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0336.11a from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0336.11a
Domain Number 1 Region: 98-259
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.53e-24
Family CRAL/TRIO domain 0.0069
Further Details:      
 
Domain Number 2 Region: 341-476
Classification Level Classification E-value
Superfamily PapD-like 3.74e-24
Family MSP-like 0.0033
Further Details:      
 
Domain Number 3 Region: 20-92
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000314
Family CRAL/TRIO N-terminal domain 0.0048
Further Details:      
 
Weak hits

Sequence:  B0336.11a
Domain Number - Region: 262-294
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0732
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: B0336.11a   Gene: B0336.11   Transcript: B0336.11a
Sequence length 567
Comment pep:known chromosome:WBcel215:III:5706692:5709284:-1 gene:B0336.11 transcript:B0336.11a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSDISNSRILRRRSSTFTDPTNLLAVHELRSRILQDPAISVKHLSDDVHRIRHEDWWLD
RFLGSVNYDVDIAYAIMLECLKWRRNFEVDRISLLSLKPLLDNQLMYLHGKDLQNRHMLW
IMMNKYKNGDDGFEKLFTFWIERHYMEYKGCQPLTVFIDMTGTGLKNMSFDAMKFIIHSS
KYYYPNSIESILIFENPAILNASWKVIGSWLESSAASQRHDLLTFVTKLSVTHYVPKSHL
LEHQGGTDTFKFTMDELAKCLPPPPPPKPSPKLLQQRMHSIDDSTNNNVTEFDFSSFQKR
NVKFDEESTTKRAPSLSRRSSRGPKSRKSHIPPSLRPLIENRVNAPSDDWSSNDFVSITP
RDELRLEKLDGENDLLDVVLVKNQSSDTPIMFKFKTTSPEKFRVRPSSGIVQPGTTEIIR
VYLQYEYRHSWNKEKFLLLTMESSSTDVESFSEQFKSASNKAEFKFKCRLSENLKLDQPE
ERRSSFLLQQQQLLSKPEGFSLGGFNIYLPIITLILFLFLIFQFSYILQMRSDNALLRET
LVSLSSQIKEASVPLQETIVEAVKNEL
Download sequence
Identical sequences Q10956
6239.B0336.11a B0336.11a B0336.11a NP_498232.3.50509 B0336.11a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]