SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2030.6 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2030.6
Domain Number 1 Region: 349-824
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.09e-121
Family PIWI domain 0.006
Further Details:      
 
Domain Number 2 Region: 53-371
Classification Level Classification E-value
Superfamily PAZ domain 6.12e-71
Family PAZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: D2030.6   Gene: D2030.6   Transcript: D2030.6
Sequence length 824
Comment pep:known chromosome:WBcel215:I:7585320:7588363:-1 gene:D2030.6 transcript:D2030.6 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSGRGRGRGSGSNNSGGKDQKYLGTIQPDLFIRQQGQSKTGSSGQPQKCFANFIPIE
MTQSDYSIYQYHVEFEPTVDSKANREKMLRDNNVTDEIGHHFVFDGMILYLKEEWEQNQM
IEVQHPIDRSLICIRFKQTNRFLVDDPQTINIFNTIIRRSFDALQLTQLGRNYFNWGDSR
AVPDYNMSILPGYETAIRMYEENFMLCVENRFKMVREESMYILFHKELRSCQNNPQRVQE
KMNEMYGGTTIITRYNNKLHRYTRLDYSISPLSEFVKDGQSITLKEYFKNQYGIEITVDD
QPIIISEGKPKQPGEPPQVSYIVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLVE
SRKLIVDLSKNEKVMECFKYWGISLGQDLANVQARVLKSEPLQGKKTYEGKQAEWARGVK
ECGIYRGSNMTNWIVIGPGSGNSGLLSQKFIEEARRLGKILQVQLGEPMCVPIRGISPND
YLEGVKGAIKQVDGEDIHMLVVMLADDNKTRYDSLKKFLCVECPIPNQCVNLRTLAGKSK
DGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKNTMIVGYDLYHDSTLKGKTVGACVS
TTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKALKQYYDSNDQTLPSRLILYRDGAGDGQ
IPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLAFIIVTKRVNMRILKQGSSLDNAI
NPQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDDTDLGPDKHQQLAFKLCH
LYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDANGCLRDKLFFL
Download sequence
Identical sequences P90786
D2030.6 6239.D2030.6.2 D2030.6 D2030.6 D2030.6 NP_492121.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]