SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F07C3.10 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F07C3.10
Domain Number 1 Region: 193-421
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-40
Family Nuclear receptor ligand-binding domain 0.0062
Further Details:      
 
Domain Number 2 Region: 32-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.67e-20
Family Nuclear receptor 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: F07C3.10   Gene: F07C3.10   Transcript: F07C3.10
Sequence length 562
Comment pep:known chromosome:WBcel215:V:9256841:9261101:-1 gene:F07C3.10 transcript:F07C3.10 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEGEDDPCSSSSIYDMSLYGNFAEKSEMSNEMCRVCGKNSAGKHYSVPACHGCKSFF
RRAIIHKTAYPECKYDKMCFSKISRITRPRKCRYCRLQKCYEVGMVAIVAMHRKHDDSPL
RSSDSELPDLPLPSPIATRENYVSGIIDKLHSLDIQTDKFRKSAYNPLFIPNLEGILASP
GKLALADKYGAMPGWPLTQESFNEQQILMNQVNGDVLTDSSSSFVLPTADTPGINTKDWL
GFDMLTAIEYAKTFPFFQQLESNDKILLTKATTFMNLALTSNYSSFLSKMAVLQMPDGIC
ISGPVGQGEHEIRSFERRLSLRIMAPLIRNLFDRTEYVLLKAIILCNHAVTDLSCAAQNI
LTRERHNFTGALLLYCLSRHGSHAGPARYYSIINMIDVLEHYQRDFRDFMLLLDISLPTR
FAKHRKFLQREILNINVVCMVAISIILCPIFYLPMYGYQSNGLFRFVDWNLALPAIFTVY
CILGVVISVMDLFHYRLKAILTMNTKPRNLKIKRFVQQLIYLAYTVLVFTAVSYLGLLKI
QSSQDAIKPLVFEVSKLTAFWF
Download sequence
Identical sequences 6239.F07C3.10 NP_001294717.1.50509 F07C3.10 F07C3.10 F07C3.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]