SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F09C3.1 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F09C3.1
Domain Number 1 Region: 39-190
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.14e-25
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 1292-1391
Classification Level Classification E-value
Superfamily RGC domain-like 3.01e-24
Family RGC domain 0.0019
Further Details:      
 
Domain Number 3 Region: 765-1096
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000145
Family p120GAP domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F09C3.1   Gene: F09C3.1   Transcript: F09C3.1
Sequence length 1391
Comment pep:known chromosome:WBcel215:I:14263289:14271305:1 gene:F09C3.1 transcript:F09C3.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEPATPHLNGLESLPSPISDGESSEVLEDVDERRLNRIAYEYLCRCEEVRTWLSECLN
DDTLVPTTDLEENLRNGVLLARLGNSFAPEVVPEKGIFDIRQEKYRQNDATPVYRHSDNI
MQWRRAMESVRLPEIFIPETADVFEGRNMKTVFCLFALATLLHRQRKAPPMRNLAGKAKF
SANELVTAKENLKDSKLPEFGDVGSMLSDRKNDANAQALAMTALQEAVAEKDAGKVLEVL
KSAPASIDYVEDSLAQQYLDGLQGEEEPLAKIFVQSVVNSVNNKSAMEQLETLLASDSDP
STIIHILDLLQIEDVRQFATSLYVTLLRDAQKSHSPLQEDNVREAIAHGNALVEVRIAVE
HGSSEDVLKALLNPHLKLENVEKSNARLYSNRLKKEFEGIEGFLLREQLSQIVNEFCKIS
EEDRVVLELNGAVQRGDSESIEQILQSRDFYVQENLEFYVKRVALKKPQNLEDLKSTMQE
INAEVEEAFKLAEQVVRINKAKGSEPKVRKELEKLKSFKLDGYREELLHWYAKRISEELD
ASKHPESSQDFWLDHKFPLGTIYVNTSTSKHSTTSQEPLHPNFLRWNPELQDFVAYENVN
FDEYWKEKEKEVVKGQAALRKFLGQKKAAKEAELKKEQDAAATKIQSHYKVFRNRKDLEL
LKTSTTPSLSLVRKFVKQLPRGEVDFSGDLEVAESKTEVSRLMASNRQLDKNLEEMDEKI
GLLIKNRLNLQEVIAHRDKTAASAEDYAAKNEVSEKKQREKCSVESLEQLLYYLQTKPNY
LANLIENLRENRTEMMTDVVSPIFGFLSDNREQFLFVRLLCELLGRNVSQLRLIEDFQSN
YFMQAIADTMKLSTFDNILSDPCQSIIDELTDFVDEESRVKTFHLDPVDLYMNLYGRPVE
SAEKALQDTDVSDVLSGSISFLAKWSERFMDAVFKSFKLPKSCVYMTSYLETALRHQFPA
ATAMQIDQTVAMFAYKVFLSHHLTSPRSLFRALGKQITDDATHRLEAIIHFTENAVANKG
YANKMWFLSLLNANVHVIHNKFIDYINKNVRNVALDEIYSMNEFTQFDPFHKPTLSLIDK
HLQTVIECLRKNKSTITEESENQLVQLIDSIADVATSDGVVMLQLHPSPNEMLPDGTQAH
LFTRAKKELVELLLEGVPGNHVGELLDEKKELTLHLKSIQTDLKKDVEQLEADGRTQKSD
NYQSIVTDIANDIRLHERRQRERQEQKKSIAATKRKLMEQREELHEKLARYEEYLETCLQ
NLSRTSRRLSFRPNTKEAGKIQKERASLDQIKSYKSTAEKLFKKGVIREITGYQTPKRIS
KLNVEFGSTDMMGVFSVALTEGKNQVGSATLQFQDLLKADSVDENTYVLAELITLDVPKT
IQYINKKFYNK
Download sequence
Identical sequences O17772
F09C3.1 NP_493492.1.50509 F09C3.1 6239.F09C3.1 F09C3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]