SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F16H11.5 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F16H11.5
Domain Number 1 Region: 304-520
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.13e-31
Family Nuclear receptor ligand-binding domain 0.0054
Further Details:      
 
Domain Number 2 Region: 2-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-24
Family Nuclear receptor 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: F16H11.5   Gene: F16H11.5   Transcript: F16H11.5
Sequence length 525
Comment pep:known chromosome:WBcel215:X:4656439:4660291:-1 gene:F16H11.5 transcript:F16H11.5 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCLVCETDAHGQHFGIRCCRACAAFFRRTLTMNLRYKCRFDRKCEVSFNKRYSCRCCRY
EKCVRVGMRKDNLTSPVSVVQNKSETEKDSSGNETDSIGHSPHSSLESYTCRPPSFEQQQ
QNQNPDPPLLMGNNGTFVQEVASDAYQPNSDMHQLNFSFHRTVIEEVGRAVMPTPPFQQP
PIHIPQPFDYQYTDLLSTDEQNSSAIPSSFTQYNQVPQEYNNESGNQNQMFAMAAQQATQ
DLHVNVQNVLTPTIDAMFGQPPDAFCQLPDIPLTLCQQALLAYREHNKQWPDQDKMIENV
PLDMENFMRNHYIEIEHIARFCMSIRVFAQLPKDQKWIIFKHFWTRFYELDRCFATCQRL
GYNLTDERGLTLNGQIINFGISVVKLENISDMDATQVRNFLKGSMDKFRLIFINPFKKLQ
PTEYELMYMMMSIMWSVSNLPGITDATRDISEKVELRLAEDLHTYYAEQYDNNNPNYAGR
ITRLSSIASAVDEITERKREDSQVSKTFNIFKNDFFFSDLTDFPV
Download sequence
Identical sequences Q19496
NP_508797.3.50509 F16H11.5 6239.F16H11.5 F16H11.5 F16H11.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]