SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F44A6.2.1 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F44A6.2.1
Domain Number 1 Region: 251-491
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-31
Family Nuclear receptor ligand-binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 149-224
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-27
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F44A6.2.1   Gene: F44A6.2   Transcript: F44A6.2.1
Sequence length 534
Comment pep:known chromosome:WBcel215:X:10201334:10205373:-1 gene:F44A6.2 transcript:F44A6.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFETKPNYLLLTNPDTPLSVCTSPYYSPSGKTASIPSSEASKPEGTNGQWSHLPTGATY
VTDEFSSEFQIQNGSTAAQSGNANNYADPLSHRRYFNNVNGYNHHQFYDTASQASVSSPA
TSVTSSLSPPDSLSNGHTTQRHHIGKAISFCKVCGDKASGYHYGVTSCEGCKGFFRRSIQ
RKIDYRCLKQQVCEIKRESRNRCQYCRFKKCLDSGMSKDSVRQMKFRNAMRDDKSPDSVF
VPEISTLERQEEVDAVYEAVLRAHTTFSFYTDIKIRSIVARPFNVRINEDSKMNRLNAWQ
IYAHEIDVDIKEVVNFVKEIPKFNFINGNDKAVLLRKNAFPLYLLRIVRGMSNRGLMLRD
GRLIDFKSLQLLYGSLADEMLAFANHIITIGCTDGDIALFIVLILCQPLTTEQQFSTNFK
SQLQLLEMFDFYKKVLFQKMTCRIDGCDTYKQLMKCIHELNRLNELHKQQLNILRENLSF
LNLPPLVVEMFQLSTLPLPVNHNNQENQYTPAPEHQSPQPQQPTPNQQQTPVHC
Download sequence
Identical sequences P41830
AAA96982 F44A6.2A F44A6.2.1 F44A6.2.2 6239.F44A6.2.2 NP_001024662.1.50509 F44A6.2.1 F44A6.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]