SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F55D12.2a from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F55D12.2a
Domain Number 1 Region: 233-321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000023
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 2 Region: 8-150
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000112
Family CRAL/TRIO domain 0.008
Further Details:      
 
Domain Number 3 Region: 394-546
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000835
Family Spectrin repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  F55D12.2a
Domain Number - Region: 544-652
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0188
Family DNA repair protein MutS, domain III 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F55D12.2a   Gene: F55D12.2   Transcript: F55D12.2a
Sequence length 712
Comment pep:known chromosome:WBcel215:I:7889351:7894850:1 gene:F55D12.2 transcript:F55D12.2a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQKQRQHVLDRLAFVPGGTDREGNALLVISTSQVQECSYENLVSLLALLSDTLPPSTL
FTVLLDTRHIQLKQLKFYLRACQQALYKKVRQVLIIQPEKFLDQQKINFDLIVSGYTLKT
VLVSMHKLSKFVDVNQLPEQFGGTLGYDPDSWLSKRIEIKKWQNYLVEVDADSSKHSLDD
DQKLEEFITKLQSTKRIEDEYASNILKKSVRDVKLKEEENSKEGLIKDHTAGVSDFLDWI
EGSGEKWLNSLCQVADNVDEAESLVKQHEELTNKTKEIEEQSHQLAEMATRLMAACPQVA
IVLQKTREQIRDVAEHFAYRVEAQTQFAVSNRTFREKVAEFIKKSDLMLEKVCAEDGASV
KTVEELTSTKKELDDLVNSMNVSFETAMDAGEETVAKARQYSEVLPAEEFVSHIGSSLTY
ISQRQNRHNELASVKRLEQQQHLQLMTTYGDCDQAIKWLGELKETLHKEYSLSDIDEDAV
KNLRNDRQNLDRTAVSTYQYGKQLLSMAKNSERSAMKESSTDERKEKLETAWKELNLAIQ
NNEQRLKVVESFMATHRQMMERVNEIEKSLRERLRVSGKLNSIVLSTERKRLKNDIEELS
NIGNMLSAQINADHATTLQDRQTAVKQISDKINEVMTAQRRMESLIIEEEEAGSSSSGKE
DKHSSRKARPLSKVPEEEGGDVSPVFPRAVRLLETNEGIAPAIRLSKNESYL
Download sequence
Identical sequences Q20833
F55D12.2a F55D12.2a NP_001250623.1.50509 6239.F55D12.2 F55D12.2a F55D12.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]