SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K06B4.10 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K06B4.10
Domain Number 1 Region: 129-355
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.13e-24
Family Nuclear receptor ligand-binding domain 0.0073
Further Details:      
 
Domain Number 2 Region: 21-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-19
Family Nuclear receptor 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: K06B4.10   Gene: K06B4.10   Transcript: K06B4.10
Sequence length 405
Comment pep:known chromosome:WBcel215:V:15698509:15699880:-1 gene:K06B4.10 transcript:K06B4.10 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTLARVLNNIGSASSNEPIPYCLICSEVADGNHFGVAAACRACAAFFRRTVQHNKIHEC
GRNGQCFFLSCKFLLVGFQISPLSSDARSMCKACRYGKCLEMGMQRSSVQQRREQLGKRL
NISDDRGKPVLNKLRRAYEMLILNRKHVHNRRENQAPRAIGFNELPIVFQNESTSIYQFL
WEAFPEYSMLLPDTKLAFFKNFFLSFCLFESSFNGCSAKQKNVMLIPSGDYIDLAHSESF
FTNDHQTFTERDNIEILAQRLKLIQSSITVPLSAENVDIYEFLALAGIILLESDSESEAD
FQEEAVKIKSNIIKDLLFHYQCINIYDDAAMRLGAVLSILPSIQVCCSRSNNFLIINSKD
VSESQSPFSRIHGNQKYAQFVRSSQESLRHVLANFIKFICKFVSI
Download sequence
Identical sequences O17934
K06B4.10 NP_506905.1.50509 K06B4.10 6239.K06B4.10 K06B4.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]