SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M79.1a from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M79.1a
Domain Number 1 Region: 299-568
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-79
Family Protein kinases, catalytic subunit 0.0000000104
Further Details:      
 
Domain Number 2 Region: 189-331
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-37
Family SH2 domain 0.0000266
Further Details:      
 
Domain Number 3 Region: 115-207
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000118
Family SH3-domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: M79.1a   Gene: M79.1   Transcript: M79.1a
Sequence length 1224
Comment pep:known chromosome:WBcel215:X:10605769:10624122:-1 gene:M79.1 transcript:M79.1a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHSHSTGKEINDNELFTCEDPVFDQPVASPKSEISSKLAEEIERSKSPLILEVSPRTPD
SVQMFRPTFDTFRPPNSDSSTFRGSQSREDLVACSSMNSVNNVHDMNTVSSSSSSSAPLF
VALYDFHGVGEEQLSLRKGDQVRILGYNKNNEWCEARLYSTRKNDASNQRRLGEIGWVPS
NFIAPYNSLDKYTWYHGKISRSDSEAILGSGITGSFLVRESETSIGQYTISVRHDGRVFH
YRINVDNTEKMFITQEVKFRTLGELVHHHSVHADGLICLLMYPASKKDKGRGLFSLSPNA
PDEWELDRSEIIMHNKLGGGQYGDVYEGYWKRHDCTIAVKALKEDAMPLHEFLAEAAIMK
DLHHKNLVRLLGVCTHEAPFYIITEFMCNGNLLEYLRRTDKSLLPPIILVQMASQIASGM
SYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMKEDTYTAHAGAKFPIKWTAPEGL
AFNTFSSKSDVWAFGVLLWEIATYGMAPYPGVELSNVYGLLENGFRMDGPQGCPPSVYRL
MLQCWNWSPSDRPRFRDIHFNLENLISSNSLNDEVQKQLKKNNDKKLESDKRRSNVRERS
DSKSRHSSHHDRDRDRESLHSRNSNPEIPNRSFIRTDDSVSFFNPSTTSKVTSFRAQGPP
FPPPPQQNTKPKLLKSVLNSNARHASEEFERNEQDDVVPLAEKNVRKAVTRLGGTMPKGQ
RIDAYLDSMRRVDSWKESTDADNEGAGSSSLSRTVSNDSLDTLPLPDSMNSSTYVKMHPA
SGENVFLRQIRSKLKKRSETPELDHIDSDTADETTKSEKSPFGSLNKSSIKYPIKNAPEF
SENHSRVSPVPVPPSRNASVSVRPDSKAEDSSDETTKDVGMWGPKHAVTRKIEIVKNDSY
PNVEGELKAKIRNLRHVPKEESNTSSQEDLPLDATDNTNDSIIVIPRDEKAKVRQLVTQK
VSPLQHHRPFSLQCPNNSTSSAISHSEHADSSETSSLSGVYEERMKPELPRKRSNGDTKV
VPVTWIINGEKEPNGMARTKSLRDITSKFEQLGTASTIESKIEEAVPYREHALEKKGTSK
RFSMLEGSNELKHVVPPRKNRNQDESGSIDEEPVSKDMIVSLLKVIQKEFVNLFNLASSE
ITDEKLQQFVIMADNVQKLHSTCSVYAEQISPHSKFRFKELLSQLEIYNRQIKFSHNPRA
KPVDDKLKMAFQDCFDQIMRLVDR
Download sequence
Identical sequences P03949
M79.1a NP_509778.2.50509 6239.M79.1a M79.1a M79.1a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]