SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T07C5.2 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T07C5.2
Domain Number 1 Region: 93-330
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.87e-43
Family Nuclear receptor ligand-binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.23e-16
Family Nuclear receptor 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: T07C5.2   Gene: T07C5.2   Transcript: T07C5.2
Sequence length 334
Comment pep:known chromosome:WBcel215:X:12703259:12704750:-1 gene:T07C5.2 transcript:T07C5.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNFGDCVVCGVSTHLFKYGKYLCNSCDLFFRRSMTPWSFFGDCKHNWDCYKESSNRQRL
PKCRHCRFNKCVDVGLLTVSRYTKLADLVEYLSLLDANREKTFLKLSISTDFDTNTFLDE
NPIRFIKKTSDLNFDCDEWQIMNKLSTIEMLKNLDFPKYLSSQDLRYFLKKGYFLKGILT
MAMRSYLNQEEFMSFPNGVDLFPDHAREGLHINISFLNLIRCQLVGKFIELKITREEISM
LGAIAVSNPAVPDLSSNGQKLLSCYQQLYTSSLLQYCLAKYQQNGPARFCNIMSVLNVAN
QTYDNIIKYVCLCQYYHSDMQPSKLYQSVLNQLN
Download sequence
Identical sequences Q22298
NP_510122.1.50509 6239.T07C5.2 T07C5.2 T07C5.2 T07C5.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]