SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T27B7.3 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T27B7.3
Domain Number 1 Region: 157-383
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.98e-41
Family Nuclear receptor ligand-binding domain 0.0077
Further Details:      
 
Domain Number 2 Region: 6-98
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-25
Family Nuclear receptor 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: T27B7.3   Gene: T27B7.3   Transcript: T27B7.3
Sequence length 387
Comment pep:known chromosome:WBcel215:V:2294821:2297007:1 gene:T27B7.3 transcript:T27B7.3 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNTLFLCRICGKNAHGTHFGVITCRACGVFFRRSFKSKWIFKKCKKEDEGKICTCKPCR
LQKCVEMGMSSKNFQYDRDAILAKHLTPSISYFVGRPEFLLFCDPSHSAPKILINLDGLV
SEASRLLRNGVESVVFAETQLKKLALGLKVMQADMRSLKYFEKIGKPEFLDIIEYYFTTV
IKWISHFDEFRKLDQNIQMKLVQSIWHILMKFHKCSATVAYRKSSDEKTRQLQKVIRNVC
LDREKMKMDFSWMSDYPAHHVLRCMFSHKSYDFEIIESLSKVDPTDVELTYMFAQSCFEY
AGKRFQGDILKITDHFQQVLSNDLHHYYITEQRRERYFQRLTDLMKVNNLIQRSIWETRS
RRELGRVFNILKVQFSHPDMLEDSGFG
Download sequence
Identical sequences O16661
6239.T27B7.3 T27B7.3 NP_503630.1.50509 T27B7.3 T27B7.3 T27B7.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]