SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y47G6A.5a from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y47G6A.5a
Domain Number 1 Region: 309-598
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-69
Family Protein kinases, catalytic subunit 0.00000489
Further Details:      
 
Domain Number 2 Region: 200-348
Classification Level Classification E-value
Superfamily SH2 domain 3.32e-20
Family SH2 domain 0.001
Further Details:      
 
Domain Number 3 Region: 127-200
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000962
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y47G6A.5a   Gene: Y47G6A.5   Transcript: Y47G6A.5a
Sequence length 618
Comment pep:known chromosome:WBcel215:I:3533997:3539159:1 gene:Y47G6A.5 transcript:Y47G6A.5a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHKHSHHEKKNKKDERNNNREYRSAVLLDDGSFSSQELALRPVMPESTPSVAVPAKPPP
LRPSTQSVSSTDPRPPIPPRRSESNLVPPPIPHHSGNISRHPSATSTKSVPNGASFSPRP
VSKTHSHHGSAKCSHSEPEEKMLIVENRFLAQTPKEMSVEEGDVLYLIEQSNREWWYVAS
KSRQFKGFVPKSHVVYAEYREPWFAGNISSILAEQRVMQPQLPIGSFLIRENSKTDTFVL
VVRSSHNESPQAYIIYRRPNQEGFEIRDNHRPAVIHFGSLHQLVNHYSCEKVPGEIQICT
KLTKAAPPLPEQTEYMAMKKIHVNRSEVRRVKEIGRGQFGEVYLAKWKGVDVAVKSLKPD
HSEQLANTQFLEEAKTLTKLSHQNVIHLLAVCDTDKPYLIITEFMTNGSLLAWLQKLTKT
LPPIPLMSEETGRKNVLIGASISAQVASGMDYLSANKIVHRDLAARNVLVGTVSSNGVPL
VKVADFGLARKTDVGDENYVMKTDNMLPWKWMAPECFDEQIFNTKTDVWSYGILLWEIGT
LGKTPYRGWDYEGTLEHLSRGYVLPRPELVPDYVYEDAFKICVHLDPRRRPTFDRLFKYF
DEINCESLSSQRFTSSRH
Download sequence
Identical sequences Q9N3S5
6239.Y47G6A.5a Y47G6A.5a NP_491175.2.50509 Y47G6A.5a Y47G6A.5a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]