SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y73F8A.21 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y73F8A.21
Domain Number 1 Region: 198-421
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.64e-33
Family Nuclear receptor ligand-binding domain 0.00088
Further Details:      
 
Domain Number 2 Region: 41-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-24
Family Nuclear receptor 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y73F8A.21   Gene: Y73F8A.21   Transcript: Y73F8A.21
Sequence length 672
Comment pep:known chromosome:WBcel215:IV:15400301:15407128:1 gene:Y73F8A.21 transcript:Y73F8A.21 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGGNSSNVNRNSGSSNVITLNDSDEETEDSNLGSSSSTNLCKVCGAEKAALHYGALSC
VGCKGFFRRALLKADQLECAANGECTVSVLQKTQCRSCRFNKCLREGMNPAYVRPNRDAP
PKPRKPTTTVATCDQTDRGRTTKSREEWMKKMTVEMRTILMTLLNIETKVMKGDTQQEAS
KLYPLKGIDKLSDIIETPIQLKGKRTEMRYEAYRMAGNDELCAIAYRRLIAAIDWVESLS
PLLGHLTPQDKIALVKSSFAPLMVFNFCARTAEACQDENVLCLCNFAYVPRNISKMYEDT
YHLGNGLVERALNELVAVYREYGMREEEIVCVNAMICLNPLAKDVSDSLFEKIVELRNRI
ADCLFSIVKEVRLSPTPNVCYGHILLSLATVTELANAMSENLQFAQTFSNQGEIPLLTDL
FGCFTVEPFFKEVDELAAMSLEKAKAEKKKEMSTQTDRLPPPRALLKRQATIDEDSEEPA
RQNFRLLQPPNNFYITEMLDDLRNNHAENHLISLNFDASNVSNAIASRPSFEDLGTVPSG
STVTRRIGSNIQGPSHLPQCGSTVTQRPTVPSSTTSSTFYNFPPPPGYPPLNAGYTPNVN
YPNLYQQPQYFQNFQQNNYPSQVMEQQNYGNVESTSYPFPRNDGFVYNHPNIPYSHHNNS
LQQNNFHNQYAN
Download sequence
Identical sequences Q9NA51
NP_502856.2.50509 Y73F8A.21 Y73F8A.21a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]