SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK1025.6 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1025.6
Domain Number 1 Region: 12-170
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.22e-17
Family Nuclear receptor ligand-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ZK1025.6   Gene: ZK1025.6   Transcript: ZK1025.6
Sequence length 173
Comment pep:known chromosome:WBcel215:I:11454770:11455440:1 gene:ZK1025.6 transcript:ZK1025.6 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVSAHHEGSSTESCLNCPGVDMLDKEDVEVLMKYFKFSNTWIDSIFASLISPNQVELIQ
CDHEDIAKFINHSKSTLGFSLSHLNLNIIEYSVFKSFCIWKLVYHETSIAMKIMAQEHFE
GVTSALRKYYRKESKMNDLEVATRIGDITLQIITVSNLYNDMIRLYHQIGVEF
Download sequence
Identical sequences Q9XXM1
ZK1025.6 6239.ZK1025.6 ZK1025.6 ZK1025.6 NP_492926.1.50509 ZK1025.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]