SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161344757|ref|NP_441751.2| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161344757|ref|NP_441751.2|
Domain Number 1 Region: 54-213
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.09e-62
Family Inorganic pyrophosphatase 0.00000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161344757|ref|NP_441751.2|
Sequence length 213
Comment inorganic pyrophosphatase [Synechocystis sp. PCC 6803]
Sequence
MACERAKGNSPQLRLGTRGAQRVKCDRVLSPFGCDSFVFRWRKIVDLSRIPAQPKAGLIN
VLIEIPAGSKNKYEFDKDMNCFALDRVLYSSVQYPYDYGFIPNTLADDGDPLDGMVIMDQ
PTFPGCVITARPIGMLEMIDGGDRDEKILCVPAKDPRYTYVKSINDLAGHRLDEIAEFFR
SYKNLEKKVTEILGWKDVDAVLPLVEECVKNYK
Download sequence
Identical sequences gi|161344757|ref|NP_441751.2| 1148.slr1622 gi|161344757|ref|NP_441751.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]