SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329417|ref|NP_440145.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329417|ref|NP_440145.1|
Domain Number 1 Region: 6-185
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.63e-36
Family HD domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329417|ref|NP_440145.1|
Sequence length 194
Comment hypothetical protein sll1660 [Synechocystis sp. PCC 6803]
Sequence
MNRSNPTPLTARFGDALVLANQLHAEQCRKGSRVPYISHLLGVTALVLEMGGSEDEAIAA
LLHDAVEDQGGMETLAMIENQFGRTVAALVRDCSDSTTTPKPPWEQRKQEHLEKMRQASL
AVLKISLADNLHNARTIAIDLRRHGDEIWQKFNRGKSGILWYYQSIWSIYQDRNPNAWSN
ELIDIIDGWRYGKL
Download sequence
Identical sequences P72810
WP_010871455.1.11876 WP_010871455.1.1889 WP_010871455.1.18904 WP_010871455.1.33690 WP_010871455.1.35395 WP_010871455.1.47586 WP_010871455.1.99424 gi|383321158|ref|YP_005382011.1| gi|383324328|ref|YP_005385181.1| gi|383490212|ref|YP_005407888.1| gi|16329417|ref|NP_440145.1| 1148.sll1660 gi|16329417|ref|NP_440145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]