SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329576|ref|NP_440304.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329576|ref|NP_440304.1|
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.15e-24
Family Tryptophan biosynthesis enzymes 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329576|ref|NP_440304.1|
Sequence length 287
Comment BtpA [Synechocystis sp. PCC 6803]
Sequence
MDLFQTFQTHNPVIGVVHLLPLPTSARWGGNLTAVIERAEQEATALAAGGVDGIIVENFF
DAPFPKQRVDPAVVSAMTLIVDRLQNLVVAPVGINVLRNDAHSALAIASCVGAKFIRVNV
LTGVMATDQGLIEGNAHELLRYRRELSSDVAILADVLVKHARPLGTPNLTTAVTDTIERG
LADGIILSGWATGSPPNLEDLELATNAAKGTPVFIGSGADEDNIGQLIQAANGVIVASSL
KRHGNINEAIDPIRVSAFIEAMAEGLKSKPSKSTVVDAPAGTKSVVC
Download sequence
Identical sequences P72966
1148.sll0634 SgR175 gi|383321317|ref|YP_005382170.1| gi|383324487|ref|YP_005385340.1| gi|16329576|ref|NP_440304.1| WP_010871612.1.11876 WP_010871612.1.1889 WP_010871612.1.18904 WP_010871612.1.33690 WP_010871612.1.35395 WP_010871612.1.47586 WP_010871612.1.99424 gi|383490371|ref|YP_005408047.1| gi|16329576|ref|NP_440304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]