SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329620|ref|NP_440348.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329620|ref|NP_440348.1|
Domain Number 1 Region: 566-866
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.75e-65
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000369
Further Details:      
 
Domain Number 2 Region: 9-102
Classification Level Classification E-value
Superfamily TPR-like 0.00000000922
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Weak hits

Sequence:  gi|16329620|ref|NP_440348.1|
Domain Number - Region: 478-517
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000275
Family HAMP domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329620|ref|NP_440348.1|
Sequence length 869
Comment methyl-accepting chemotaxis protein [Synechocystis sp. PCC 6803]
Sequence
MATETNFSQLYGLAYAAYGQGNYQEASSHIEQLAADFPEDPNVLLLRGHIYVGLEQYALA
HQAYQGVIRFSDRQDLIDCANQALGQIQEEEPRGNGAKDSLDQDWQSDIDAIDNSMAWET
GVFTEEDFGEPTLGRAPSPTNPGMDHPFGRSSASFGTSGARSYEIENLDWSPEAFTDDLD
SDDEQTMMPQTGESTFVVPPAFGEGIADFADLAADVSSAGIGGTDGAEYPPYQTWDGGDW
SEALGLDDPEALAQAPTPTSGDYGAGNNLPSFDAFEEGVEDELSDFNLTDIAPELPDSSL
FSQATNLDIGAVGRIDDTQGGDTVVHGGNAAPPGMATWLKPDGAATGDLSSATSPFNDRP
TSEVDAGFLGWFTNASLFRKQIYMAIASGVFSGFAVLVLGSIVGLGGTPKDVPAPSGETT
TEAPAEGAPAEGQAPSQTPEEEPGKPSLLNLAFLTAIATAIGVFLINRLLMQQIKSIIDD
LQNQFESIYEGNFNVRAKVRSEDELGALTQRFNYISQVILTATSEAQERAATTEKVREKL
QRQVIRLLDDVEGASRGDLTVQAEVTADELGAVADAFNLTIQNLREIVLQVKNAAKQVNN
NCKDSESFARNNSSDALRMAEELAVTLNSVQLMTESIERVAENAREAEEVAHTSSLTALK
GGEAVERTVGGILQIRETVSETARKVKRLAEASQEISKIVAVISQIASRTNLLALNASIQ
AARAGEAGRGFAIVADEVRQLADRSAKSLKEIEQIVLQIQSETGSVMTAMEEGIQQVIDV
TDKSEQSKRALEDIIEVSNRINTLVRSITADTVKQQENSGAVSNVMQSIELTAQETSQES
QRVAGSLQTLVSISRDLLTSVERFRVESR
Download sequence
Identical sequences P73008
gi|16329620|ref|NP_440348.1| gi|383321361|ref|YP_005382214.1| WP_010871656.1.11876 WP_010871656.1.1889 WP_010871656.1.18904 WP_010871656.1.33690 WP_010871656.1.35395 WP_010871656.1.47586 WP_010871656.1.99424 1148.slr1044 gi|383490415|ref|YP_005408091.1| gi|16329620|ref|NP_440348.1| gi|383324531|ref|YP_005385384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]