SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329644|ref|NP_440372.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329644|ref|NP_440372.1|
Domain Number 1 Region: 42-347
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.07e-36
Family Filamentous hemagglutinin FhaB, secretion domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329644|ref|NP_440372.1|
Sequence length 1749
Comment hypothetical protein slr1753 [Synechocystis sp. PCC 6803]
Sequence
MVEILLISPLIAVLNPSLRLFCLALLACSSSFSGNVLAQNITPAPDGTGTTVDAQGNQFN
IGGGSLSGDGQNLFHSLQQFGLDQGQIANFLSNPDIRNILTRIVGGDASIINGLIQVSGG
NANLFLMNPAGMIFGPNASINVPGDFVVTTGSAIGFGNDQWFQVFSDNDYNALIGNPSQF
AFDLANPGLIINAGDLSVTEGKNLTFLAGNIVNTGSLAAPGGNITVAAVPGQNRIRISQA
GSLLSLEVEVSPQMNQGGSFSVLDLPTLLTQGASNLDLGLAVQPNGSVTTNGTNALVSPL
PGSVTISGNVDASGKSTNISSGGQVAIAGDQIAVQGATVDVSGNGGGGTVRIGGDFQGQL
TLPNASQTLIDSNSVVKADALLTGNGGTVIVWADDSTRFSGNISAQGGTMGGNGGFVETS
GAKSLMVDDTARVNTFATMGELGTWLLDPLEIIVGTTDDLLADPKLVSVLTITTSLDNGN
VILQADQSIAVQANFSADPSAPGNLTFDSPTITIDALFSLGTGSIIFANTGPINTGNTLV
TSPFTNLDFDNKIQLNANTTFTAPGYDIYFRKSVNGGFDLLGNANFVYFDDGAGITTPLK
SFGVTATEIYVGNDIVTQGNQIFDGVFYGLQPVNLTSSAGSVIFTNNILLNGSLQVQTAQ
NIVSQPSSSLSAVEIASDVLLNAGQNVSFGNINTRGGNVDIQALGNISTGSIVTSPFGGN
AGNVILNAGGTLTTGYIETSGTNGGDVTTSSGSNTSTAYIDTRGFGDGLEIDSLGGAVSI
ESKGDITTAFIDTGAYSIESFNEGTGGNVFLTADGSITTNYIFTAGKNGGDIFFQAGESI
EIIDYLNTYGSQTSGDVYVEAPLDISIGSYIYTGGGGEPGNVFLQAGGDITTSYIDTSAA
NGGDIFIQSGGDTEVGYLFTKGYEGRGGDVYVETGRYFRAIDGFLLGEEGPFSVYTAGLT
VGGSVYIQFGGSEPFIIGNPITNGTIGAISSGDDNTVPIGTPPIFDTFTLDNITITTEPE
PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPEPEPELPTPSIPVEPPTSPDVEEIDDERQISFDIERSTV
TNTPSLEIQSQDTVPGINTFSANVGVNIPTNQVVLQQQLNENVEESISAQFTSHLNLNID
IELVNPVDVLQELNLNTGVNSALVYIYFYPPGTAGENLPEWQLSSDSEPAIPPVGSYAKV
SHWQMASTEQLIIPPNNDPRPDDQLVIVVVTADGIASPIPLNVSRREVIRQVEMLNRNLT
AANRGDNYQGQASQLYDWFIKPIKLILENKKIENISFILDRGLRSLPMATMYDRQSGQYL
IEDYSVGLMPSLSLTNRDYAPLTGAQILAMGAEEFANQNPLPAAAVEVDTITNQLWRGSA
FLNDRFTVDNFVQSLATKEYRLVHLATHGEFLPGNRNNSFVVFSDRSLDLDEFANVGLDK
PIDLMVLSACRTAVGDFDAELGFAGLAVKTGVKTAIGSLWYVSDEATFALMTSFYDRLQP
APIKAKALQQAQLSLLRGEIRVVDGNLVLGDGTNISLADLPADIRQRLATQDLSHPYFWS
GFTLVGSPW
Download sequence
Identical sequences L8AGX5 P73032
gi|383321385|ref|YP_005382238.1| gi|16329644|ref|NP_440372.1| gi|16329644|ref|NP_440372.1| SgR54 gi|383490439|ref|YP_005408115.1| WP_010871680.1.11876 WP_010871680.1.18904 WP_010871680.1.33690 WP_010871680.1.35395 WP_010871680.1.47586 WP_010871680.1.99424 1148.slr1753 gi|383324555|ref|YP_005385408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]