SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329661|ref|NP_440389.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329661|ref|NP_440389.1|
Domain Number 1 Region: 40-146
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 2.88e-26
Family Oxygen-evolving enhancer protein 3, 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329661|ref|NP_440389.1|
Sequence length 149
Comment hypothetical protein sll1638 [Synechocystis sp. PCC 6803]
Sequence
MSRLRSLLSLILVLVTTVLVSCSSPQVEIPTTYSPEKIAQLQVYVNPIAVARDGMEKRLQ
GLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAK
DRNGSQAKIQYQEALADFDSFLNLLPQAS
Download sequence
Identical sequences L8AFL1 P73048
gi|383321402|ref|YP_005382255.1| gi|16329661|ref|NP_440389.1| gi|383324572|ref|YP_005385425.1| gi|16329661|ref|NP_440389.1| WP_010871697.1.11876 WP_010871697.1.1889 WP_010871697.1.18904 WP_010871697.1.33690 WP_010871697.1.35395 WP_010871697.1.47586 WP_010871697.1.99424 gi|383490456|ref|YP_005408132.1| 1148.sll1638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]