SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329681|ref|NP_440409.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329681|ref|NP_440409.1|
Domain Number 1 Region: 2-350
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.44e-74
Family TK-like PP module 0.0081
Further Details:      
 
Domain Number 2 Region: 290-480
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.28e-63
Family TK-like Pyr module 0.019
Further Details:      
 
Domain Number 3 Region: 493-624
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.49e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329681|ref|NP_440409.1|
Sequence length 640
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Synechocystis sp. PCC 6803]
Sequence
MHISELTHPNELKGLSIRELEEVSRQIREKHLQTVATSGGHLGPGLGVVELTVALYSTLD
LDKDRVIWDVGHQAYPHKMLTGRYHDFHTLRQKDGVAGYLKRSESRFDHFGAGHASTSIS
AGLGMALARDAKGEDFKVVSIIGDGALTGGMALEAINHAGHLPHTRLMVILNDNEMSISP
NVGAISRYLNKVRLSSPMQFLTDNLEEQIKHLPFVGDSLTPEMERVKEGMKRLVVPKVGA
VIEELGFKYFGPIDGHSLQELIDTFKQAEKVPGPVFVHVSTTKGKGYDLAEKDQVGYHAQ
SPFNLSTGKAYPSSKPKPPSYSKVFAHTLTTLAKENPNIVGITAAMATGTGLDKLQAKLP
KQYVDVGIAEQHAVTLAAGMACEGIRPVVAIYSTFLQRGYDQIIHDVCIQKLPVFFCLDR
AGIVGADGPTHQGMYDIAYLRCIPNLVLMAPKDEAELQQMLVTGVNYTGGAIAMRYPRGN
GIGVPLMEEGWEPLEIGKAEILRSGDDVLLLGYGSMVYPALQTAELLHEHGIEATVVNAR
FVKPLDTELILPLAERIGKVVTMEEGCLMGGFGSAVAEALMDNNVLVPLKRLGVPDILVD
HATPEQSTVDLGLTPAQMAQNIMASLFKTETESVVAPGVS
Download sequence
Identical sequences L8AGS4 P73067
gi|383490477|ref|YP_005408153.1| SdR31 WP_010871718.1.11876 WP_010871718.1.1889 WP_010871718.1.18904 WP_010871718.1.33690 WP_010871718.1.35395 WP_010871718.1.47586 WP_010871718.1.99424 1148.sll1945 gi|16329681|ref|NP_440409.1| gi|383324593|ref|YP_005385446.1| gi|383321423|ref|YP_005382276.1| gi|16329681|ref|NP_440409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]