SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329703|ref|NP_440431.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329703|ref|NP_440431.1|
Domain Number 1 Region: 16-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-56
Family ABC transporter ATPase domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329703|ref|NP_440431.1|
Sequence length 289
Comment ABC transporter [Synechocystis sp. PCC 6803]
Sequence
MLTVPSPNANVPMVDSLLSQPVIAVENLFAGYGATPVLENINLRVEERDFLGLIGPNGGG
KTTLLKVLLGLIQPQQGTVQILGRSVEQGRRYVGYVPQWLEFDRAFPVRVLDVVRMGRLG
RGKLFRRYHQQDEAIVRRCLEQVGMGDLGDRPLGTLSGGQRQRVYIARALASQPQILLLD
EPTANVDSKVQRSIYELLGELNQTMTIVMISHDLGAISRYVKTVGCLNRSLHYHQEKFIT
PQMIEATYQCPVDLIAHGVPHRVFPSHDPALPGLDATNGQGHTAECHHD
Download sequence
Identical sequences P73086
gi|383324615|ref|YP_005385468.1| 1148.slr2044 gi|383490499|ref|YP_005408175.1| gi|16329703|ref|NP_440431.1| gi|383321445|ref|YP_005382298.1| gi|16329703|ref|NP_440431.1| WP_010871740.1.11876 WP_010871740.1.1889 WP_010871740.1.18904 WP_010871740.1.33690 WP_010871740.1.35395 WP_010871740.1.47586 WP_010871740.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]