SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329706|ref|NP_440434.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329706|ref|NP_440434.1|
Domain Number 1 Region: 1453-1558
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-16
Family Cadherin 0.0048
Further Details:      
 
Domain Number 2 Region: 839-937
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000419
Family Cadherin 0.006
Further Details:      
 
Domain Number 3 Region: 1351-1447
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000288
Family Cadherin 0.0074
Further Details:      
 
Domain Number 4 Region: 1241-1348
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000055
Family Cadherin 0.0067
Further Details:      
 
Domain Number 5 Region: 1555-1660
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000011
Family Cadherin 0.0056
Further Details:      
 
Domain Number 6 Region: 1045-1150
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000327
Family Cadherin 0.005
Further Details:      
 
Domain Number 7 Region: 940-1040
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000353
Family Cadherin 0.0076
Further Details:      
 
Domain Number 8 Region: 1147-1252
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000419
Family Cadherin 0.017
Further Details:      
 
Domain Number 9 Region: 1654-1747
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000111
Family Cadherin 0.01
Further Details:      
 
Domain Number 10 Region: 736-834
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000119
Family Cadherin 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329706|ref|NP_440434.1|
Sequence length 1965
Comment cadherin [Synechocystis sp. PCC 6803]
Sequence
MSVYNLDLSLVYGKLSAFAGLESFWQNFEIIYGNNYDVVAVEALRSRWAIGDFSDLPVIE
VLSAETLGSAVGAYAQSINKIYLSDQFVATAPPDALIEVILEEIGHFVDAQVNAVDTIGD
EGQLFADLVLGDVVSASELARIKAEDDTHTIIINGQSLQVEQSVQSLIGESVTVNVRFTG
SGSDGSFNFDLFTQTFTVTSGQEITDQAITATFNSSGSPQTLTGNVDIDVSENTIYVNFS
GTQQGGALTFIFTSLADESIGSVESVIQTNVSGFTTGVNQPLTPSVSNNNVTVGFFPFGS
QPGVNLSQTSTLTYGTPPTDNTPPNAPSTPDLSASSDSGLSSTDNITNDTTPTFNGTAEA
NSTVTLFSGGSTQIGSTTANGSGNWTITASTPADGNYSITAKATDAAGNVSTASSALGIT
IDNTTPNLASAIEISDTALKIGDTATVTFTFSEAVIGFTNADIIVVDGSLSSPTSSDGGI
TWTATLTPNANAESNSNVITLDNTGISDLAGNNGTGTTTSVSYAVDTIPPTLTSIDDGDD
DNIVPIDTPLTYTLTFSEDIDSTTVTADDFDNAGTATISIGTITETSSGVFSVVVTPNTS
GTIILQIPNGAVLSDMAGNNLAVPVQDDDELQVNQGPSAVIVPNASLAENTDTTNPLKVA
DIAITDDGLGSNDISLSGIDAAFFEVIGQSLFLKAGTVLNFESKASYTVTVNVDDDTVGS
TPDLTADFKLTINNLDEVAPTITSGDTAKAIAENSGANQIIYQVKATDDGDISAGITFGL
KPGDDADSFIINATTGEVKLIGNPDFETQSSYKFTVTADDGVNPATEQLVNLAIIDLDEI
APTITSGDTAKAIAENSGANQVIYQVTATDDADVSAGITFGLKPGNDADLFIINSTTGQV
ILTENPDFETQSSYKFTVTASDGVNPATEKIVTLAIIDLDEIAPTITSGDTAKAITENSG
ANQVIYEVIATDDADVSAGITFGLKPGNDAGSFTINPITGKVTLIDDPDFETQSSYKFTV
TASDGVNLATEQLVNLTIIDLDEIAPTITSGDTAKAIAENSGANQVIYEVIATDDADVSA
GITFGLKPGNDAGSFTINPITGKVTLIDDPDFETQSSYKFTVTASDGVNLATEQLVNLTI
IDLDEIAPTITSGDTAKAITENSGANQIIYQATADDNADISAGVTFGLKPGDDADSFIIN
AITGQVTLLDNPDFETQSSYKFTVTASDGVNPVTEQVVNLTIIDLDEIAPTITSGNTAKA
IAENSGANQVIYQVTATDDADISAEVTFGLKLGDDATSFSIDSTTGKVTLINNPDFESQS
SYKFTVTASDGVNPATEKIVTLAINNLDEIGPTITSGDTATPIDENSGANQLIYQVIATD
DADVSAGITFGLKPGNDAGSFTINPITGEVTLIDDPDFETQSSYKFTVTASDGVNPATEK
IVTLTINDLDELGPNITSDNIATAINENSGANQIIYQVTADDGDDISAGVTFGLKPGDNA
NQFSIDPTTGQVTLLDNPDFETQSSYKFTVTASDGVNPATEQLVNLTIIDLDEIAPTITS
GDTAKAIAENSGANQVIYQVTATDDADTSAGVTFGLKPGEDANSFTINAATGEVELIGNP
DFETQSSYKFTVTASDGVNPVTEQVVNLTIIDLDEIAPTITSGNTAKAIAENSGANQVIY
QVTATDDADISAGVTFGLKPGDDATSFSIDSTTGKVTLINNPDFESQSSYRFTVTADDGV
NPVTEQQIALEILDDNVAVIENGFFFAQFLDNTRQALLFQNQPFSTDQSVNWKILDTETV
DGSNQVLWYNQVTEEVGVWLTDNNWNWISSDTWQVKSSRTFNTELLFGTDINGDSLIGDQ
YTVLENQGAVGLLEGIFGAYYVQPGDDPVTPLKFLGQPFENQFGSWQALAAERVENINRV
LWQNFDTGEIGIWRTDNNWNWLSSNVFTPNSTEIATVESLFGISL
Download sequence
Identical sequences L8AHE9 P73089
gi|383324618|ref|YP_005385471.1| gi|16329706|ref|NP_440434.1| WP_010871743.1.11876 WP_010871743.1.1889 WP_010871743.1.18904 WP_010871743.1.33690 WP_010871743.1.35395 WP_010871743.1.47586 WP_010871743.1.99424 gi|383490502|ref|YP_005408178.1| gi|383321448|ref|YP_005382301.1| gi|16329706|ref|NP_440434.1| 1148.slr2046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]