SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329791|ref|NP_440519.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329791|ref|NP_440519.1|
Domain Number 1 Region: 654-952
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 5.23e-58
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000382
Further Details:      
 
Domain Number 2 Region: 553-599
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000432
Family HAMP domain 0.0052
Further Details:      
 
Domain Number 3 Region: 17-64,100-143
Classification Level Classification E-value
Superfamily TPR-like 0.00000569
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329791|ref|NP_440519.1|
Sequence length 953
Comment methyl-accepting chemotaxis-like-protein [Synechocystis sp. PCC 6803]
Sequence
MVSTPTKPQFSQEILELQAAAMAAPDDLFAQIVLAGALQQEGFWEEAAQYYRQAQELDSD
GIYGETISKALAEIQPNLPAVEEIPAIPQPLTEEEKKQVYPPEILMLQETVQERPDDLVA
QISFASALEAGGFLTDALQAYEDLKINDEEGIFHATCDQAIAGIEAQLADPNRITPAMAW
TGTLKYAAATDDLALDEERSNLTLQKRWANLPIATKQFTALLVSSAITVVAVVGTGMMIA
ISSGRFQLKNQTLAELVVTEGNYNIKIDQMSFGFRGQSDNLAIIQAARLYSERQPIPAPL
AAQVRDILKNETASRDIEYATLVGQDQRIIASANAQRNGQIFDPSNLVTLRMGYPGQIKF
STIVSKEELEKELPPGIDNLEQENALIRYTVTPVQDPQSKKNIGTLIAGDIVNGKDAIVK
NTVDNFDGGYSAVYYIDPNGEIQLATSNLKTGSGQNTKVYENVAFPDLELLKKAQENPDM
PLVGRTTVEGEPLTVAIKVIKDIQGQPLALLVRGTSEVEFNDLLERTLLLQIGVGAVALL
VAAIIAYWLGKTLTKPLKNLQTTAQKLGEGETGVRAEVESKDEVGQLAVTFNAMAEQVEA
STRSLQETSLERQQEAEKQRQLKEELQDGVVRLLTDIEESSRGDLTVRSSVEAGAVGAIA
DAFNATLAGLRKLVKQVVDTATEVSGQAQEDSQEITSLSDNALEQARALEFATASVAEMA
QSIESVAISAQTAAAIAKQGNEAAQQGQNTMDETVESIYKVRGRVAEISKKSKRLAESSL
EISKIVGIISGISEKTNLLAFNASIEAARAGENGQGFRIVADEVRRLAEMVTLSAQEIEQ
VILSIQEETSQMSQLMEESTNEVVTGTQLVQKTKETLQNLAQISEEIDTVLDSISRNTES
QRLASQMVTETVQNVASVAKATSDKSQLVSQSLQSLAKTAVDLQTAAGKFKVE
Download sequence
Identical sequences L8AE25 P73173
gi|383324703|ref|YP_005385556.1| WP_010871828.1.11876 WP_010871828.1.1889 WP_010871828.1.18904 WP_010871828.1.33690 WP_010871828.1.35395 WP_010871828.1.47586 WP_010871828.1.99424 gi|383490587|ref|YP_005408263.1| gi|16329791|ref|NP_440519.1| 1148.sll1294 gi|383321533|ref|YP_005382386.1| gi|16329791|ref|NP_440519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]