SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329830|ref|NP_440558.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329830|ref|NP_440558.1|
Domain Number 1 Region: 4-286
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.42e-66
Family AstE/AspA-like 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329830|ref|NP_440558.1|
Sequence length 288
Comment aspartoacylase [Synechocystis sp. PCC 6803]
Sequence
MVNSAVRSLAIVGGVHGNERTGVEVVRRWQQKDFARYFPALKCHYFLANPRAIAANRRYI
NQDLNRCFRPQDRKNPYLMGYEQLRARQLAHQISLAGIDFIVDLHTTTAAMGTTLILNCP
HPLLLNLAAYLSAQDEEIRVLQYSPQKDLPYIRGLCELGLTIELGPVPQGVYDPTAIAKT
QRTLARILAYLQASTSGNVPAADNCTVYQQIDTIDYPRDEQGQIVAEIAPHIRDYQAIKP
GTPLFYHRRGNVTPYQGAATVYPVFIGEAAYVEKGIAMALTQRKTIAI
Download sequence
Identical sequences L8AG67 P73211
gi|16329830|ref|NP_440558.1| gi|383324741|ref|YP_005385594.1| gi|383321572|ref|YP_005382425.1| 1148.slr1705 gi|383490625|ref|YP_005408301.1| WP_010871867.1.11876 WP_010871867.1.1889 WP_010871867.1.18904 WP_010871867.1.33690 WP_010871867.1.35395 WP_010871867.1.47586 WP_010871867.1.99424 gi|16329830|ref|NP_440558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]