SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329902|ref|NP_440630.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329902|ref|NP_440630.1|
Domain Number 1 Region: 8-328
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.76e-117
Family TK-like PP module 0.00000000189
Further Details:      
 
Domain Number 2 Region: 341-533
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.23e-64
Family TK-like Pyr module 0.000000428
Further Details:      
 
Domain Number 3 Region: 538-670
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-41
Family Transketolase C-terminal domain-like 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329902|ref|NP_440630.1|
Sequence length 670
Comment transketolase [Synechocystis sp. PCC 6803]
Sequence
MVVATQSLDELSINAIRFLAVDAIEKAKSGHPGLPMGAAPMAFTLWNKFMKFNPKNPKWF
NRDRFVLSAGHGSMLQYALLYLLGYDSVTIEDIKQFRQWESSTPGHPENFLTAGVEVTTG
PLGQGIANGVGLALAEAHLAATYNKPDATIVDHYTYVILGDGCNMEGISGEAASIAGHWG
LGKLIALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVEDGNTDLAAIAKAIEEAKA
VTDKPSMIKVTTIIGYGAPNKSDTAGIHGAALGTDEVAATRKNLGWDYAPFEVPQEVLDY
TRKAIERGASYEAEWNQAFAQYKTKYPTEAAAFERQLSGALPEGWDKTLASFTPDQKGLA
TRKYSEECLNALAPVLPELIGGSADLTHSNLTELHCSGDFQKGAYQNRNVHFGVREHAMG
AICNGIALHGSGLLPFGATFLIFTDYMRAAIRLSALSEAGVIWVMTHDSIGQGEDGPTHQ
PIEVLASLRAIPNLTVIRPADGNETSGAYKVAIAKAKENAPTLLSLTRQAVPNLPGTSID
AVAKGAYTIVDSEGVPELILIGTGSEVQLCVAAAEKLAAQGKKVRVVSMPSWELFETQDA
AYKESVLPKAVTKRLSVEAATNFGWHKYVGTEGDTVSIETFGASAPGGVCLEKFGFSVDN
VLAKAKTLLS
Download sequence
Identical sequences L8AGC9 P73282
gi|383321645|ref|YP_005382498.1| gi|383490698|ref|YP_005408374.1| gi|16329902|ref|NP_440630.1| gi|383324814|ref|YP_005385667.1| 1148.sll1070 WP_010871940.1.11876 WP_010871940.1.1889 WP_010871940.1.18904 WP_010871940.1.33690 WP_010871940.1.35395 WP_010871940.1.47586 WP_010871940.1.99424 gi|16329902|ref|NP_440630.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]