SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329984|ref|NP_440712.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16329984|ref|NP_440712.1|
Domain Number - Region: 8-107
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0691
Family N-acetylmuramoyl-L-alanine amidase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329984|ref|NP_440712.1|
Sequence length 129
Comment hypothetical protein slr1210 [Synechocystis sp. PCC 6803]
Sequence
MIKFYSNENLSLGLVNQLRQLGYSVLTSYDAGRANQRITDLSVLKDATTDGRCVITFNRN
DFIELHLNRIKHKGIIICKEDRDQIGQASIIHDFLINQKTLDNRLIRILKQNQPGLKQPQ
FTIKEYYPS
Download sequence
Identical sequences L8AHY5 P73361
1148.slr1210 gi|383490780|ref|YP_005408456.1| gi|383324896|ref|YP_005385749.1| WP_010872022.1.11876 WP_010872022.1.1889 WP_010872022.1.18904 WP_010872022.1.33690 WP_010872022.1.35395 WP_010872022.1.47586 WP_010872022.1.99424 gi|16329984|ref|NP_440712.1| gi|16329984|ref|NP_440712.1| gi|383321727|ref|YP_005382580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]