SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330037|ref|NP_440765.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330037|ref|NP_440765.1|
Domain Number 1 Region: 8-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.5e-67
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000716
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.66e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330037|ref|NP_440765.1|
Sequence length 324
Comment Pyruvate dehydrogenase E1 component subunit beta [Synechocystis sp. PCC 6803]
Sequence
MAETLLFAALRQALDEEMGRDVNVLVLGEDVGLYGGSYKVTKDLYEKYGEMRVLDTPIAE
NSFTGMAVGAAMTGLRPVIEGMNMGFLLLAFNQIANNAGMLRYTSGGNYQIPMVIRGPGG
VGRQLGAEHSQRLEAYFHAVPGLKIVACSTPYNAKGLLKAAIRDNNPVLFFEHVLLYNLK
ENLPDYEYIVPLDKAEVVRPGKDVTILTYSRMRHHCLQALKTLEKEGYDPEIIDLISLKP
FDMETISASVKKTHRVIIVEECMKTGGIGAELIALINDHLFDELDGPVVRLSSQDIPTPY
NGMLERLTIVQPPQIVDAVKAIIG
Download sequence
Identical sequences L8AEM2 P73405
gi|383321780|ref|YP_005382633.1| gi|383324949|ref|YP_005385802.1| gi|383490833|ref|YP_005408509.1| WP_010872075.1.11876 WP_010872075.1.1889 WP_010872075.1.18904 WP_010872075.1.33690 WP_010872075.1.35395 WP_010872075.1.47586 WP_010872075.1.99424 1148.sll1721 gi|16330037|ref|NP_440765.1| gi|16330037|ref|NP_440765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]