SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330286|ref|NP_441014.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330286|ref|NP_441014.1|
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000547
Family 7-Fe ferredoxin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330286|ref|NP_441014.1|
Sequence length 75
Comment ferredoxin [Synechocystis sp. PCC 6803]
Sequence
MPHTIVTETCEGVADCVEACPVACIHPGDGKNTIGTDWYWIDFATCIDCGICLQVCPVEG
AILPEERPDLQKSPA
Download sequence
Identical sequences L8AFJ0 P73649
gi|383491080|ref|YP_005408756.1| gi|383322027|ref|YP_005382880.1| 1148.ssr3184 gi|16330286|ref|NP_441014.1| gi|383325196|ref|YP_005386049.1| gi|16330286|ref|NP_441014.1| WP_010872324.1.11876 WP_010872324.1.1889 WP_010872324.1.18904 WP_010872324.1.33690 WP_010872324.1.35395 WP_010872324.1.47586 WP_010872324.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]