SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330357|ref|NP_441085.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16330357|ref|NP_441085.1|
Domain Number - Region: 2-77
Classification Level Classification E-value
Superfamily PhoU-like 0.00977
Family PhoU-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330357|ref|NP_441085.1|
Sequence length 141
Comment hypothetical protein sll1630 [Synechocystis sp. PCC 6803]
Sequence
MEELLELKQLVQSGQTTAALALIDELETMSKEDKINKIYSYCVVLLIHLIKQQAEARSTN
SWEVSIRNAINAIERINKRRKAGCYYVSQSDLQEILAEADDRALDNASLEAFGGIYNAAY
LAEKVDRNAIISQAIKLISFA
Download sequence
Identical sequences L8AJD1 P73718
gi|383491151|ref|YP_005408827.1| 1148.sll1630 gi|383325267|ref|YP_005386120.1| gi|16330357|ref|NP_441085.1| WP_010872395.1.11876 WP_010872395.1.1889 WP_010872395.1.18904 WP_010872395.1.33690 WP_010872395.1.35395 WP_010872395.1.47586 WP_010872395.1.99424 gi|16330357|ref|NP_441085.1| gi|383322098|ref|YP_005382951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]