SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330364|ref|NP_441092.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330364|ref|NP_441092.1|
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily CheY-like 3.84e-25
Family CheY-related 0.0023
Further Details:      
 
Domain Number 2 Region: 159-321
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.91e-23
Family HD domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330364|ref|NP_441092.1|
Sequence length 334
Comment regulatory components of sensory transduction system [Synechocystis sp. PCC 6803]
Sequence
MNQISPLRIFLLDDHPYSRIASADLLRLNNYQIIEGETTKGFSCGQVVEQVEKVDPDLVL
MDVNLAHQNGIELCQAIKHSPVGQYIPIILTNAMDDPQCRLRSRASGADAYLLKPLERVE
LLNQVDLLIQKKKLAESVAQIEQVLFRLAAVIEERYAVGEASITCSQLIEGFGEFIGLEQ
GQIDDLVFAARLHDLGLIQVPDEIMLKQGPLNSTELDCVRDHVHVAATIFEPLAGRRAVG
EIMRYHHERWDGSGYPDALRGKEIPLLAQVFQIIDIFTALTSNRRYKEAVNTAQALEILQ
GEARRGWRNPEMVEKFVNFINKNSIEESLAQKLN
Download sequence
Identical sequences L8AHM4 P73724
gi|16330364|ref|NP_441092.1| gi|383322105|ref|YP_005382958.1| gi|383325274|ref|YP_005386127.1| 1148.sll1624 WP_010872402.1.11876 WP_010872402.1.1889 WP_010872402.1.18904 WP_010872402.1.33690 WP_010872402.1.35395 WP_010872402.1.47586 WP_010872402.1.99424 gi|383491158|ref|YP_005408834.1| gi|16330364|ref|NP_441092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]