SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330405|ref|NP_441133.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330405|ref|NP_441133.1|
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 8.25e-65
Family Decarboxylase 0.00000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330405|ref|NP_441133.1|
Sequence length 231
Comment orotidine 5'-phosphate decarboxylase [Synechocystis sp. PCC 6803]
Sequence
MTPDQVIVALDVPDLPKAIALVDRLPGVGFWKVGLELFVGAGPVILAELKDRGKRIFLDL
KFHDIPNTMLGACLSASRYEVDLLTLHATAGSQALTLAAQAMAPLPHPPKLLAITLLTSI
GDRQLREELQQPLAVDDYVNAMARLARNAGIDGAVCSPQEVAKLRQTCGPEFLLVTPGVR
PLWSAPGDQQRVMIPAQAIAAGANYVVIGRPITADPSPEAAWERLCQDLAV
Download sequence
Identical sequences L8AJ07 P73761
gi|16330405|ref|NP_441133.1| gi|383322146|ref|YP_005382999.1| gi|383491199|ref|YP_005408875.1| NYSGRC-FDAO-BAA17813 1148.sll0838 gi|383325315|ref|YP_005386168.1| WP_010872442.1.11876 WP_010872442.1.1889 WP_010872442.1.18904 WP_010872442.1.33690 WP_010872442.1.35395 WP_010872442.1.47586 WP_010872442.1.99424 gi|16330405|ref|NP_441133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]