SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330456|ref|NP_441184.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330456|ref|NP_441184.1|
Domain Number 1 Region: 1-576
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 5.76e-188
Family Prokaryotic type I DNA topoisomerase 0.00000000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330456|ref|NP_441184.1|
Sequence length 898
Comment DNA topoisomerase I [Synechocystis sp. PCC 6803]
Sequence
MSKLVIVESPTKARTIRNYLPQDYRVEASMGHVRDLPASAEEVPAAYKDKSWANLGVNVE
DHFSPLYVIPKSKKKVVKELQTALKNADEVILATDEDREGESISWHLLQLLQPKVPIKRM
VFHEITQEAIRSALENCRDIDENLVHAQETRRILDRLVGYTLSPLLWKKIAWGLSAGRVQ
SVAVRLIVQRERARRAFKTAGYWDLKAELEQNKNPFQAKLMTLGGTKLANGSDFDPNTGA
LLPDKQVVVLDEAQAIALKERLTGKPWAVVNTEEKPGVRKPSPPFTTSTLQQEANRKLGI
SARDTMRVAQKLYEEGYITYMRTDSVHLSDQAVTAARNCVQQMYGKEYLSPQPKQYTTKS
KGAQEAHEAIRPAGTEFRIPNQTGLKDRELALYELIWKRTVACQMADARITQLSVLLKVE
DAEFRAAGKRIDFPGYFRAYVEGSDDPDAALENQEVILPPLKVGDRPNCREIDTVGHETQ
PPARYTEASLVKTLESEGVGRPSTYASIIGTIIDRGYVQMRSKALTPTFTAFAVVSLLES
HFPDLVDTGFTSRMEQKLDEIAIGKTQWLPYLQGFFLGESGLENQVKVRQDQIDPAIAKA
IELENLAAKVKIGKFGPYIEIPQGEEIITASIPQDLTPADLNPEQVAVLLKQKTEGPDKV
GIHPETGEPIFILIGAYGPYVQLGEATEENKKPKRTSLPKGVKPEDVTLEMAVGLLALPR
NLGEHPESGKNIKASLGRFGPYVVHDQGKDGKDYRSLKGDDDVLTITLERALELLAEPKR
GRGSRTPLKQLGLHPEDQEPVNLFKGPYGVYIKHGKVNASLPEGETEETITLEKALPLLA
EKAGSGKKTSRKKATTTAKGTKKTTSKKASATGTAKKTTTKRTTRKKAASPDQSSEAG
Download sequence
Identical sequences L8AJC1 P73810
gi|16330456|ref|NP_441184.1| gi|383491250|ref|YP_005408926.1| 1148.slr2058 gi|383322197|ref|YP_005383050.1| WP_010872493.1.11876 WP_010872493.1.1889 WP_010872493.1.18904 WP_010872493.1.33690 WP_010872493.1.35395 WP_010872493.1.47586 WP_010872493.1.99424 gi|383325366|ref|YP_005386219.1| gi|16330456|ref|NP_441184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]