SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330457|ref|NP_441185.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330457|ref|NP_441185.1|
Domain Number 1 Region: 66-130
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.54e-18
Family Short-chain ferredoxins 0.056
Further Details:      
 
Domain Number 2 Region: 3-71
Classification Level Classification E-value
Superfamily ACT-like 0.000000000017
Family NIL domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330457|ref|NP_441185.1|
Sequence length 134
Comment ferredoxin [Synechocystis sp. PCC 6803]
Sequence
MKKRVTLTFPRSAVQMPVTYRLAKDFNIAANIIRAQVAPNQVGKVVLELSGDIDQLEASL
EWMRSQSIEVSLASREIVIDDQSCVDCGLCTGVCPTEALSLDPDSFRLMFRRSRCVVCEQ
CIPSCPVQAIATNF
Download sequence
Identical sequences A0A068MUH4 P73811
gi|383325367|ref|YP_005386220.1| gi|383491251|ref|YP_005408927.1| 1148.slr2059 gi|383322198|ref|YP_005383051.1| gi|16330457|ref|NP_441185.1| WP_010872494.1.11876 WP_010872494.1.1889 WP_010872494.1.18904 WP_010872494.1.33690 WP_010872494.1.35395 WP_010872494.1.47586 WP_010872494.1.709 WP_010872494.1.99424 gi|16330457|ref|NP_441185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]