SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330558|ref|NP_441286.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330558|ref|NP_441286.1|
Domain Number 1 Region: 6-142,215-347
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.57e-65
Family Carboxypeptidase T 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330558|ref|NP_441286.1|
Sequence length 558
Comment hypothetical protein sll0236 [Synechocystis sp. PCC 6803]
Sequence
MTVSPFDFSHYFTYQEIDQFLQQLQTSYGSLLTVQTIGQSYAGRDIWVAIATNQATGDYR
NKPGYWIDANTHAGEVTGSAVALYCLHQLMTKYGEDAQITHLLDHYTVYVLPRLAMDGAE
KYLTTPYLLRSSVRPYPYPEERDGLYPEDVNGDGLILQMRLLDPCGAWKISDQDPRVMIG
RSPEEFGGEYYTLLPEGLVRNYDGYEFDLAPTQEGLDFNRNYPHQWAPEGQQQGAGDFPF
SEPETRAEAEFWQQHRNINGFISYHTYSAVILRPYASQADENLPVEDLEVYKILGQKGKE
LTGYNCISAYHDFRYHPKEVIYGVMDDYAYDHYGWFGFTVELWDAPTAAGIEKEDLIEWF
RWHPPEDDYKLMQWNDQALSGEGFVHWQPFDHPQLGKVEIGGWSFKTMWQNAPAQFLPEL
CEQQFRFAITHALMAPRLAVAKAEITAQGENIYQITVQWENQGFLPTYTSQKALERKAVR
PIQVTLKKTDSVTLITGKIHQELPHLEGRSNKAKSSLANGIDYRRHLIWVIRGNPGEKLT
ITAQAERAGTVKVELTLP
Download sequence
Identical sequences L8AJM4 P73902
gi|16330558|ref|NP_441286.1| gi|383325468|ref|YP_005386321.1| gi|16330558|ref|NP_441286.1| gi|383491352|ref|YP_005409028.1| WP_010872593.1.11876 WP_010872593.1.1889 WP_010872593.1.18904 WP_010872593.1.33690 WP_010872593.1.35395 WP_010872593.1.47586 WP_010872593.1.99424 gi|383322299|ref|YP_005383152.1| 1148.sll0236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]