SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330569|ref|NP_441297.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330569|ref|NP_441297.1|
Domain Number 1 Region: 208-383
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.22e-65
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000359
Further Details:      
 
Domain Number 2 Region: 14-200
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.33e-64
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000305
Further Details:      
 
Domain Number 3 Region: 392-588
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.33e-62
Family Pyruvate oxidase and decarboxylase PP module 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330569|ref|NP_441297.1|
Sequence length 621
Comment acetolactate synthase 3 catalytic subunit [Synechocystis sp. PCC 6803]
Sequence
MVASIPNPKTNFLKTVPSQRQTGAYILMDSLKRHGVKHIFGYPGGAILPIYDELYRFEAA
GEIEHILVRHEQGASHAADGYARATGKVGVCFGTSGPGATNLVTGIANAHLDSVPMVVIT
GQVGRAMIGSDAFQEIDIFGITLPIVKHSYVVRSAADMARIVTEAFHLASTGRPGPVLID
IPKDVGLEECEYIPLDPGDVNLPGYRPTVKGNPRQINAALQLLEQARNPLLYVGGGAIAA
NAHAQVQEFAERFQLPVTTTLMGIGAFDENHPLSVGMLGMHGTAYANFAVSECDLLIAVG
ARFDDRVTGKLDEFASRAKVIHIDIDPAEVGKNRAPDVPIVGDVRHVLEQLLQRARELDY
PTHPHTTQAWLNRIDHWRTDYPLQVPHYEDTIAPQEVVHEIGRQAPDAYYTTDVGQHQMW
AAQFLNNGPRRWISSAGLGTMGFGLPAAMGAKVGVGDEAVICISGDASFQMNLQELGTLA
QYDIQVKTIILNNGWQGMVRQWQQTFYEERYSASNMSQGMPDINLLCEAYGIKGITVRKR
EDLAPAIAEMLAHNGPVVMDVVVKKDENCYPMIAPGMSNAQMLGLPEVPVRDNGPRMVEC
NHCQTQNFITHRFCSGCGAKL
Download sequence
Identical sequences P73913
WP_010872604.1.11876 WP_010872604.1.1889 WP_010872604.1.18904 WP_010872604.1.33690 WP_010872604.1.35395 WP_010872604.1.47586 WP_010872604.1.99424 gi|16330569|ref|NP_441297.1| 1148.slr2088 gi|383491363|ref|YP_005409039.1| gi|383325479|ref|YP_005386332.1| gi|16330569|ref|NP_441297.1| gi|383322310|ref|YP_005383163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]