SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330586|ref|NP_441314.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330586|ref|NP_441314.1|
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily CheY-like 5.55e-40
Family CheY-related 0.00078
Further Details:      
 
Domain Number 2 Region: 159-353
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.16e-33
Family HD domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330586|ref|NP_441314.1|
Sequence length 368
Comment regulatory components of sensory transduction system [Synechocystis sp. PCC 6803]
Sequence
MNTPPDPNSKATILVVDDTPDNLALMSGLLKDYYRVKIANNGEKALKVAQTLPPPDLILL
DIMMPGIDGYEVCAHLKANPATQRIPVIFLTAKSEIEDERKGLALGAVDYITKPVSPPIL
MARVNTQLTIKAAADFLLDKNAFLEQEVARRTQEMMAIQDVTIQVMASLAETRDHETGNH
IRRTQNYVRALAEQLKNHPRFQKFLTDHTINLLYKSAPLHDIGKVGVPDHILLKPGPLTA
EEFEIMKTHTTLGRDAIVQAEKSLGMKVDFLQLAKEIAYSHQEKWDGTGYPQGLSGDDIP
IAARLMAIADVYDALISSRVYKEAMPHEEAVAIIEAGYGQHFDPDVVDAFMAIHPTFKTI
AAEFADKG
Download sequence
Identical sequences L8AJJ3 P73928
WP_010872619.1.11876 WP_010872619.1.1889 WP_010872619.1.18904 WP_010872619.1.33690 WP_010872619.1.35395 WP_010872619.1.47586 WP_010872619.1.99424 gi|383325496|ref|YP_005386349.1| gi|16330586|ref|NP_441314.1| gi|383322327|ref|YP_005383180.1| gi|16330586|ref|NP_441314.1| gi|383491380|ref|YP_005409056.1| 1148.slr2100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]